"action" : "rerender" "event" : "unapproveMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "componentId" : "forums.widget.message-view", "context" : "", ] "action" : "rerender" "message" : "2126669", { "event" : "deleteMessage", ] { "actions" : [ "triggerEvent" : "click", { "event" : "deleteMessage", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); "event" : "kudoEntity", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "linkDisabled" : "false" "includeRepliesModerationState" : "false", ] "action" : "pulsate" "parameters" : { // We made it! }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); }); "action" : "rerender" } "eventActions" : [ ] }, "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "markAsSpamWithoutRedirect", { "kudosable" : "true", } ] { "context" : "", }, "disallowZeroCount" : "false", { { "action" : "pulsate" ] "event" : "ProductAnswerComment", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "selector" : "#kudosButtonV2_0", }, "message" : "2126572", ] "event" : "markAsSpamWithoutRedirect", "actions" : [ "action" : "rerender" } } "useSubjectIcons" : "true", } { "action" : "rerender" "showCountOnly" : "false", "actions" : [ disableInput(pagerId); }, "actions" : [ }); "useTruncatedSubject" : "true", } "message" : "2061916", clearWarning(pagerId); "action" : "rerender" } }, }, "actions" : [ "context" : "", "action" : "rerender" "revokeMode" : "true", "actions" : [ { // just for convenience, you need a login anyways... "quiltName" : "ForumMessage", "truncateBody" : "true", "kudosLinksDisabled" : "false", } var notifCount = 0; }, "actions" : [ { "event" : "removeThreadUserEmailSubscription", "}); { ] "useSubjectIcons" : "true", "action" : "rerender" watching = true; "displayStyle" : "horizontal", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/82300/page/8","ajaxErrorEventName":"LITHIUM:ajaxError","token":"zXPTeu5nylv5a8yb7N5_3zANwFXDbCgJ9Jfev9Q2CJ4. } }, "includeRepliesModerationState" : "false", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ;(function($) { "context" : "", ] "initiatorBinding" : true, ;(function($) { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { "kudosable" : "true", { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); }, { "context" : "lia-deleted-state", resetMenu(); "actions" : [ { })(LITHIUM.jQuery); ] { ] ] "actions" : [ }, "componentId" : "kudos.widget.button", ] "context" : "envParam:quiltName,message", } "context" : "", ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); watching = false; "actions" : [ }, })(LITHIUM.jQuery); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'p_cA13zGSi9sZINLnRY0ELhS-6WlEDuUPjD3M-7QjgU. return false; "actions" : [ return; { // If watching, pay attention to key presses, looking for right sequence. "displaySubject" : "true", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "event" : "addThreadUserEmailSubscription", ] "useTruncatedSubject" : "true", }, "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "context" : "", "selector" : "#kudosButtonV2_7", "actions" : [ if (val.trim() == "") "action" : "rerender" "event" : "expandMessage", } }, "selector" : "#kudosButtonV2_6", "disableKudosForAnonUser" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", { Hab bitte etwas Geduld. "context" : "", { } { var resetMenu = function() { "actions" : [ } "action" : "addClassName" { } { "context" : "envParam:feedbackData", { { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_7","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2061916}},{"elementId":"link_12","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2061957}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2062013}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2062124}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2062200}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124196}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124541}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2124749}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2126572}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2126669}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_63","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_65","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_72","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_74","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_77","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_79","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_81","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); { "event" : "AcceptSolutionAction", { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "actions" : [ }, "showCountOnly" : "false", } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "RevokeSolutionAction", } { "action" : "rerender" o.innerHTML = "Page number can\'t exceed 11. ] "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2126669 .lia-rating-control-passive', '#form_8'); "action" : "pulsate" { { ] ] { count = 0; }, ] { }, } }, "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", { } '; ] "action" : "rerender" "actions" : [ ] { } "action" : "rerender" "context" : "", "context" : "", ;(function($) { o.innerHTML = ""; ;(function($) { ], // just for convenience, you need a login anyways... "useSubjectIcons" : "true", "event" : "ProductMessageEdit", }, } { { { { In der Praxis sah es in der Android-Version der App in den vergangenen Tagen jedoch ganz anders aus.Tagelang war die App eigentlich unbrauchbar und stürzte ständig ab. LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Teilweise hat es Tage gedauert, bis sie wieder funktioniert hat - im aktuellen Fall soll die App bereits seit dem 1. $(document).keydown(function(e) { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/82300/page/8","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lk02X0TqpyRKBbSpqNM7Ae5cY8tjTAEg-NW_to6VEUA. } { { "event" : "ProductMessageEdit", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "markAsSpamWithoutRedirect", ] { "action" : "rerender" "actions" : [ "event" : "ProductAnswerComment", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", element.removeClass('active'); }, "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "removeMessageUserEmailSubscription", "event" : "ProductMessageEdit", "context" : "", "action" : "rerender" { "selector" : "#messageview_3", } } { }, "actions" : [ if ( watching ) { ], "context" : "", { { "action" : "rerender" }); { "actions" : [ "action" : "rerender" "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, "event" : "RevokeSolutionAction", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "entity" : "2124749", } "context" : "", "context" : "", ] "actions" : [ { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ } ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "event" : "kudoEntity", "entity" : "2126572", } var handleOpen = function(event) { { "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31b9c6498e38b2', 'enableAutoComplete', '#ajaxfeedback_31b9c6498e38b2_0', 'LITHIUM:ajaxError', {}, '_rdojdlG8u_Rh9wmEKvbopjEbDqqV2MxW4g8ozhlHRw. "context" : "envParam:selectedMessage", "actions" : [ return false; { { "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "addThreadUserEmailSubscription", // We made it! "action" : "pulsate" "actions" : [ "initiatorBinding" : true, ] { "actions" : [ LITHIUM.Dialog.options['-522073303'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); "linkDisabled" : "false" } { LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Bist du sicher, dass du fortfahren möchtest? "useCountToKudo" : "false", } }, }, $(document).ready(function(){ "actions" : [ "action" : "rerender" "context" : "", "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'p_cA13zGSi9sZINLnRY0ELhS-6WlEDuUPjD3M-7QjgU. "includeRepliesModerationState" : "false", "showCountOnly" : "false", }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "selector" : "#kudosButtonV2_8", ] "; })(LITHIUM.jQuery); { "event" : "removeThreadUserEmailSubscription", { ] "context" : "",